NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0246095_102133

Scaffold Ga0246095_102133


Overview

Basic Information
Taxon OID3300029818 Open in IMG/M
Scaffold IDGa0246095_102133 Open in IMG/M
Source Dataset NameGroundwater microbial communities from Horonobe Underground Research Laboratory (URL), Japan - horonobe_ig2699
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of California, Berkeley
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9850
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (81.25%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Candidatus Methanoperedenaceae → Candidatus Methanoperedens → Candidatus Methanoperedens nitroreducens(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Horonobe Underground Research Laboratory (Url), Japan

Source Dataset Sampling Location
Location NameJapan: Horonobe URL
CoordinatesLat. (o)45.045278Long. (o)141.859444Alt. (m)Depth (m)215
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F072481Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0246095_10213311F072481N/AMLLRLKSNLFGIMIPGSKQSEDMKSRKEGTIPPFHPNLKSEKHVSCKHCGETYKENEIKRDPKSGEWVCKHYPKCEGTGWHSI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.