NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0239581_1017917

Scaffold Ga0239581_1017917


Overview

Basic Information
Taxon OID3300029798 Open in IMG/M
Scaffold IDGa0239581_1017917 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Alinen Mustajarvi, Finland - AM11
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUppsala University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1943
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Wildermuthbacteria → Candidatus Wildermuthbacteria bacterium GWA2_46_15(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Alinen Mustajarvi, Finland

Source Dataset Sampling Location
Location NameFinland: Alinen Mustajarvi in Hameenlinna
CoordinatesLat. (o)61.208142Long. (o)25.113609Alt. (m)Depth (m)5.1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023511Metagenome209Y

Sequences

Protein IDFamilyRBSSequence
Ga0239581_10179173F023511N/ANATPQVAYPAFSVMEFKVGFDHLDLVNAQYGKTVQSWEVYLMDSNDDLLSEVRVFNNDTRVFENEKVFFYRNSFSAYDTFRFLGKSELNLEYERQIGTTVREEKYSFFNAATKQFSAKETESCKANSGWISLAEKNCLRELLLSTEAYEQIGKELFQIVVKSAKVTPFLKDGEYLYNLEIEYERSYQNSFFSVHVPENSANAIILPQPLTWDNMEVSFDDMEITFDQIEY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.