Basic Information | |
---|---|
Taxon OID | 3300029781 Open in IMG/M |
Scaffold ID | Ga0167330_1068445 Open in IMG/M |
Source Dataset Name | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP11 - Uppsala-digested 112 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Gothenburg |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 530 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sweden | |||||||
Coordinates | Lat. (o) | 59.844519 | Long. (o) | 17.659844 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F078674 | Metagenome / Metatranscriptome | 116 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0167330_10684452 | F078674 | N/A | IISLRVSEKLEQVLEEQAQEWNMSISDTLRSILNFYFLPPLLLEAWEKKVQALIALDTEQRGENRADMNAPTQAQRIEPIFCDSEEAEEYANFIHELWEKGLKYFETLREEAKTMNRIAVKRLQVTAEALKKVAMELPEFKEVEKQ |
⦗Top⦘ |