Basic Information | |
---|---|
Taxon OID | 3300029349 Open in IMG/M |
Scaffold ID | Ga0238435_116312 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Oregon State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 620 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Klamath Basin, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Iron Gate Dam, Klamath Basin, California | |||||||
Coordinates | Lat. (o) | 41.93 | Long. (o) | -122.44 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F044493 | Metagenome / Metatranscriptome | 154 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0238435_1163121 | F044493 | N/A | LMSTLKWKELSEVEEYLGLPMDEWNDSPSKAKLAFAMQYVMAKRNNTALTIEQAEAMTISQLAEASGVDMTVPKEDTSA |
⦗Top⦘ |