| Basic Information | |
|---|---|
| Taxon OID | 3300029255 Open in IMG/M |
| Scaffold ID | Ga0168097_1072800 Open in IMG/M |
| Source Dataset Name | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP9 - Uppsala-digested 110 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Gothenburg |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 632 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium 49_20 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden | |||||||
| Coordinates | Lat. (o) | 59.844519 | Long. (o) | 17.659844 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F091988 | Metagenome / Metatranscriptome | 107 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0168097_10728001 | F091988 | N/A | SNYSFTGFEKLVCNPYIVAKEPVSAMFQGYEVKSGDPTQVIYTYRLKGNTYTELNLTMDWTIGPCAPAFVESNVKAPRNPLLTNYRFEFVVPVK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |