Basic Information | |
---|---|
Taxon OID | 3300029179 Open in IMG/M |
Scaffold ID | Ga0168030_106182 Open in IMG/M |
Source Dataset Name | Aquariaum water viral communities from Chicago, USA - Amazon Rising - AZ2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Michigan State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1047 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Aquaculture → Unclassified → Unclassified → Aquarium Water → Aquariaum Water Viral Communities From Chicago, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Chicago | |||||||
Coordinates | Lat. (o) | 41.87 | Long. (o) | -87.61 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F074743 | Metagenome / Metatranscriptome | 119 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0168030_1061821 | F074743 | GGA | MIDLSNKVKRDRLLKAIKSSRAAMEPFRRVRKSLIESYVGSWYTPENPQPKTLVNLINQTARIYTVALAANNPKVLVTTPHVQNYPFARRFEVNLNKLISDMALDQTFRSIVLDAFFCLGCGVVMMRDTDTRFHGLLEAEEDVWLDPGEPWLNRVSFDDLILDMPAKELSKMRYCGHRYRADYEKVMDEPGYDKKVKEKLRPVTRSFHDSVDAARDLASEYGGAEDDDMKDMIWLMDLWIAENNSI |
⦗Top⦘ |