| Basic Information | |
|---|---|
| Taxon OID | 3300028885 Open in IMG/M |
| Scaffold ID | Ga0307304_10158848 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 947 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Brocadia → Candidatus Brocadia caroliniensis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Colorado | |||||||
| Coordinates | Lat. (o) | 38.9206 | Long. (o) | -106.9489 | Alt. (m) | Depth (m) | 10 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F036308 | Metagenome | 170 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0307304_101588482 | F036308 | N/A | LSCEKLEKLPGEAKGGIDISSAAGAIGVAYLLGVIFDRFADTLLERINRWNRLLFAIDLKDEDKALSPDDPFPEDRLQIEVIHKGHEAWEWMDYLRSRIRIARAMAVFVPAVTLSIQLAIGFRAHPGMIRAILAIVVAAYVAAFLMSQILEGSSRRMPKTYDLRTDEDCQGARAKMRITTEPAFWLGVFLLALGLVLIAVGTGPGRAGMAAVLGTGAVLTAISVWTWWRTTETFMQFLADFRRLG |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |