NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307277_10010547

Scaffold Ga0307277_10010547


Overview

Basic Information
Taxon OID3300028881 Open in IMG/M
Scaffold IDGa0307277_10010547 Open in IMG/M
Source Dataset NameSoil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3558
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000280Metagenome / Metatranscriptome1383Y
F001079Metagenome / Metatranscriptome785Y
F007262Metagenome / Metatranscriptome354Y

Sequences

Protein IDFamilyRBSSequence
Ga0307277_100105472F000280AGGMADEPSQRPARPLVGYRDVGEDVRHSRRAEIRAWMILAVLAAFYLGWTLVIYFLEPGLR
Ga0307277_100105473F001079AGAAGMAEQAVVPSALPYVAWASATYAEIPADQWETVYASMQALKAHVQEYPGCQKLEAFVELEASGAVRVDCYTIWDTPEQLEAFLARGYTFERMLKGVASIDAAPARIVEKVF
Ga0307277_100105474F007262N/ASTRQKKALYPVDTFGGYTTELAGPATFFFLALTVVLIGWAVAMIVGHLVWGQKF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.