NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307278_10000653

Scaffold Ga0307278_10000653


Overview

Basic Information
Taxon OID3300028878 Open in IMG/M
Scaffold IDGa0307278_10000653 Open in IMG/M
Source Dataset NameSoil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17157
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (78.95%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009235Metagenome / Metatranscriptome321Y
F009632Metagenome / Metatranscriptome315Y
F012432Metagenome / Metatranscriptome280Y

Sequences

Protein IDFamilyRBSSequence
Ga0307278_1000065314F012432GGAGMCTAVRIVVAAAERERRLELRRAAVTAEWEVVGEADGPEAAYREAVERRARFLVLDASAAGPRPEVLVRRLRSTTPNAFVVGVGEVPGVDASLAPEALDGLREVMRDLLHESGDHQHA
Ga0307278_1000065315F009632AGGAGMRWRRAATIALTAFALLAVARPAGAMTYVGLHDLTCAGATTEGTGMPRNTSLQVALVDPASDRTLSRGRVSTGASGSFEWRATISLSGMREVRAEVRRPGQATPLAWVEHSLARGCPLASTGPNRTLPLVGVGLSSLTLGVLVLIAFAYPGRHAGPAGRHLAAPYRLR
Ga0307278_100006533F009235AGGAGMAEQRTFRALGGVDQGAPPPAGAAADALRAELERVFTLKASLRGEAEAGVSPTGRRTTAQDEAKLRTLVASVEGASRFAIRLGLLDPAQVRALWAEAMDRGLYDGWDAGQSAYDQAAEREVGDAPTSTSGAPPEVRRGDA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.