Basic Information | |
---|---|
Taxon OID | 3300028543 Open in IMG/M |
Scaffold ID | Ga0307877_118654 Open in IMG/M |
Source Dataset Name | Lab enriched biofilm microbial communities from the Montreal Biodome aquarium denitrification system, Montreal, Canada - optimal |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Genome Quebec |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 700 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Biofilm → Lab Enriched Biofilm Microbial Communities From The Montreal Biodome Aquarium Denitrification System, Montreal, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Montreal, Canada | |||||||
Coordinates | Lat. (o) | 45.5596 | Long. (o) | -73.5497 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F078533 | Metagenome / Metatranscriptome | 116 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0307877_1186541 | F078533 | GAGG | MTPDQFKQARQTLGLSQRDLAAEWGMGANGERTIRRWETGVVPVNPIAAYCIALMLGSRQARDA |
⦗Top⦘ |