| Basic Information | |
|---|---|
| Taxon OID | 3300028485 Open in IMG/M |
| Scaffold ID | Ga0233365_1000110 Open in IMG/M |
| Source Dataset Name | Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung C36 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 43119 |
| Total Scaffold Genes | 59 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 54 (91.53%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 38.04 | Long. (o) | -122.5 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003605 | Metagenome / Metatranscriptome | 477 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0233365_100011051 | F003605 | AGGAGG | VAVGDQAQAAGFPLVPDTGEEGRVRWGGREINRTRDLIAAVKALLPIGKPGYRTASGISTGTADPTGGVDGDIYFKILD |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |