NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257114_1040610

Scaffold Ga0257114_1040610


Overview

Basic Information
Taxon OID3300028196 Open in IMG/M
Scaffold IDGa0257114_1040610 Open in IMG/M
Source Dataset NameMarine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2118
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Inlet → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameCanada: British Columbia
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025289Metagenome / Metatranscriptome202Y
F041784Metagenome / Metatranscriptome159Y
F095522Metagenome / Metatranscriptome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0257114_10406101F041784AGGAGMYTKTIGYCGVDSGQLFITDPCYIKHQEQGNGQWNMEWVDTDNGRDYKTLPDPTLDGETKNFYSKVCEANGKGYEGVEVELGVAFGTTHGDGNYAVQGIFDDDDVMVGIFMDLDGRVKGEFNYETEDMWS
Ga0257114_10406105F025289AGGAMDICEERQVSKWSMKQQIIDDLEGYDELNDDNIREICNSLVPVYNSELIDLASHYSGEEYWELWLNNELGGETPLDILRGNVFALYYKIGREVLEERENEK
Ga0257114_10406106F095522GAGMEISIKPGTPPEKVFTERSGSKYDEAIKTAIANKGEWFQVASCPVDKRDSMYSTASAIRNGRLATIPQDENINIVCRRVNDSIIMFITAL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.