NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209526_10000088

Scaffold Ga0209526_10000088


Overview

Basic Information
Taxon OID3300028047 Open in IMG/M
Scaffold IDGa0209526_10000088 Open in IMG/M
Source Dataset NameForest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)50220
Total Scaffold Genes48 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)31 (64.58%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameAlgoma, Ontario, Canada
CoordinatesLat. (o)46.42Long. (o)-83.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000775Metagenome / Metatranscriptome896Y
F002714Metagenome / Metatranscriptome535Y
F005283Metagenome / Metatranscriptome406Y
F009182Metagenome / Metatranscriptome322Y

Sequences

Protein IDFamilyRBSSequence
Ga0209526_100000881F009182N/ARPFIFHYEPEDEAFRFRLQFKKSHVSRDELIRTLRDILSQLEGSNEADSTAA
Ga0209526_1000008817F000775AGGCGGMKNFDSIFAAYLIGWSVFFIFYLTIAKRSSDLRAEVERLKNSLNRNK
Ga0209526_100000882F005283AGGAMLELTALQMQTLERLFAAGFRPIAIPPYENALCVHRGECAAVLAPVENAGLRLLSPVTVMVDGNLSVKLKRASGDVFVRKKKEVVATGERLKELEKFRVELVEILEMGEKQ
Ga0209526_1000008834F002714GAGMEHIQTFQTAARESGFIEVNESSEATVLWLRKNTPNTARETHQRMCIDNLTKSATVYWMSAPGKVNSKTFRDVPSLQAWCKLEPEIVPQR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.