Basic Information | |
---|---|
Taxon OID | 3300028025 Open in IMG/M |
Scaffold ID | Ga0247723_1027933 Open in IMG/M |
Source Dataset Name | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1813 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: West Virginia | |||||||
Coordinates | Lat. (o) | 39.6017 | Long. (o) | -79.9761 | Alt. (m) | Depth (m) | 2281 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F045714 | Metagenome | 152 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0247723_10279334 | F045714 | AGG | MQEKILTPKYRKGKKPVKVRKPSKPIDGINHRLLAEQAAAKAQEVVEANEPQDDAAPTRAELEAKATELGIRFDGRTSDKKLNSLIEAKLK |
⦗Top⦘ |