Basic Information | |
---|---|
Taxon OID | 3300028023 Open in IMG/M |
Scaffold ID | Ga0265357_1012157 Open in IMG/M |
Source Dataset Name | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 884 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Norway: Oslo | |||||||
Coordinates | Lat. (o) | 59.9989 | Long. (o) | 10.7903 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F067217 | Metagenome | 126 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0265357_10121571 | F067217 | GGAG | MPGLLQRLMPREEGFFDLFAQQAENIHTGAEALLK |
⦗Top⦘ |