NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265348_100016

Scaffold Ga0265348_100016


Overview

Basic Information
Taxon OID3300028009 Open in IMG/M
Scaffold IDGa0265348_100016 Open in IMG/M
Source Dataset NamePlant litter microbial communities from Maridalen valley, Oslo, Norway - NLE6
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3574
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (88.89%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location NameNorway: Oslo
CoordinatesLat. (o)59.997Long. (o)10.7902Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F089142Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0265348_1000166F089142GGAMNFTTFVRKPFVVDAIEVTSENIAEVAKYVGDLREKEDGTPYILVDRRLVPNVFRVYPGFFMTKMGENVRCYSRKIFKEQFIVQTAEIKPWVEIMGKNDTAA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.