NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209401_1000498

Scaffold Ga0209401_1000498


Overview

Basic Information
Taxon OID3300027971 Open in IMG/M
Scaffold IDGa0209401_1000498 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)26531
Total Scaffold Genes63 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)52 (82.54%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053831Metagenome / Metatranscriptome140N
F063331Metagenome / Metatranscriptome129Y
F105052Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0209401_100049825F063331GGAGMTELDHFALLNDLKSVLDLIDNDELETARTVIDRVQADCDEKHRIYLERVERYLGHVDSALEDKK
Ga0209401_100049826F053831GAGMNHWQKLEYRGDGFQPFSIRLDYCHEDIAFRDMYAFDDDEEYITKTEKEIEEGYRYFVILRAKVYLAGVEVGSHSLGGLLFDSTEQMESMMKLDFEGIISEAVVNAKHNLRQMSEAMNGVTV
Ga0209401_100049842F105052AGGAGMSHLDEKQALIDIIKGEEKIYSQMVYTMGFQRLVKATSKEEAISKFQNDHIDVIADDENVDCDDHSEVVETDLEVTELYGE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.