NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209536_100089366

Scaffold Ga0209536_100089366


Overview

Basic Information
Taxon OID3300027917 Open in IMG/M
Scaffold IDGa0209536_100089366 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3937
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location NameWhite Oak River estuary, North Carolina, USA
CoordinatesLat. (o)34.640199Long. (o)-77.109447Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006264Metagenome / Metatranscriptome377Y
F015330Metagenome / Metatranscriptome255Y
F031403Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0209536_1000893661F015330AGGMFEMRPEGSKVTEFKKNKGGRPKSIVNKVTEYGAHFNKLNEERLSMGLPPLKTAMDVLIEAMQSDELDIKEKSRIAEKLATFESSRAPIISIEHVQNITREEDVDADQALRDFMDSLKKV
Ga0209536_1000893666F006264N/AMDYASIFREKLAGQAEVCARKMLERLQKNLHNETELMPEDIYYLSSAAQILLNIRDTYGK
Ga0209536_1000893668F031403AGGAMLDKQNIVVESLESPPGNKGIEYQIAHEVYLKMVDYLRLTQAKNTLNRMSDYHYLNIPVSNSTEPIRGIDYIYPVVSPGVDYATAVITKCLMPQGKINFEFERFTEHDKGAVQATEMVKYMLNSKNDSYQIIRDWAQDSLLHKNGIV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.