NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209698_10187907

Scaffold Ga0209698_10187907


Overview

Basic Information
Taxon OID3300027911 Open in IMG/M
Scaffold IDGa0209698_10187907 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1676
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Clearfield County
CoordinatesLat. (o)41.170727Long. (o)-78.4726Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000042Metagenome / Metatranscriptome3762Y
F018799Metagenome / Metatranscriptome233Y
F026982Metagenome / Metatranscriptome196Y
F046579Metagenome / Metatranscriptome151Y

Sequences

Protein IDFamilyRBSSequence
Ga0209698_101879071F046579GGAMDHIIQVELRTGTTHTLTWLAATLKPKPGMVLVCNGDPRPWTVVHAYHITAQETWEAHTNWKIEGHVSVRSA
Ga0209698_101879072F000042GGAGGMKNIKFVVKVTRGSHAPSFVQRTDPTPVQMTTNRKLALVMGRLTAEDIAKSIQNSKCFPELVPVQVTV
Ga0209698_101879073F018799N/AMGGTPDGLIHIEYGFVPGGTLDYLKVWSSITRGHWLLACEYWMSPSAFHNVGVRFENGYESEGLADILDSVMQHQTSFILPQNLGRQGLLQIPTPTKEEGEAATALINVALDRLASLPAV
Ga0209698_101879074F026982N/ASQQFNGLEITEIVARRFLGVPYVTVCAHSRHMQQSCYLDSAAARQTSQDNAEWARG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.