NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209089_10002218

Scaffold Ga0209089_10002218


Overview

Basic Information
Taxon OID3300027838 Open in IMG/M
Scaffold IDGa0209089_10002218 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17319
Total Scaffold Genes30 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (53.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)73.2247Long. (o)-150.2247Alt. (m)Depth (m)177
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001066Metagenome / Metatranscriptome788Y
F043442Metagenome156Y

Sequences

Protein IDFamilyRBSSequence
Ga0209089_1000221828F001066N/AMVEDIFKIKPLDKHASKVVVDGHKTVSPFNSAKHLKTANIPALCDQCVYRSIDSGGNGKCPKYEEGAMCAIRKDFIALINELDTRNPEHVKTMLDMLAKLSFENVLMALTESKFDGNIPDRNTKSEVNTLLKIISTIGEISSKIVVSEEQRFNKLGDIESIFRQIKAQKTGD
Ga0209089_1000221829F043442AGGMEALQECKVKNVVLSFKYSYANITKFRERFDKLFVVAGTKTEPERYYELLKKHRGVYDYAIQYDVMYNMNETLKHYRKEREMGIDWTIPVLQEHYLNHLSQLRLEPDTYVCLGEVHGRDETEDQIRKLPPNLKYHGLAKGRYTTKTRLFESLDTSGWISAAMSKKCEVWNNNSTNFMFFGDKGKTMIPMLNHACEVHKEYLELINLNKQDIIDGDYKALLKAPFALLYLPMCKQLNILKDNFNL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.