NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209491_10005761

Scaffold Ga0209491_10005761


Overview

Basic Information
Taxon OID3300027832 Open in IMG/M
Scaffold IDGa0209491_10005761 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17848
Total Scaffold Genes41 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (12.20%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica

Source Dataset Sampling Location
Location NameLake Bonney
CoordinatesLat. (o)-77.714Long. (o)162.445Alt. (m)Depth (m)83
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000716Metagenome / Metatranscriptome923Y
F006840Metagenome / Metatranscriptome363Y
F052406Metagenome142Y

Sequences

Protein IDFamilyRBSSequence
Ga0209491_1000576114F000716N/AMEKLKQNIKDYQMRSHTVMAYEQDNYNSYQNYLYKRALYGLNSLEQSELLTLCSKKKQRIVNVYKKAQVVLNKLKQEITIKYSNFIFESLFPESPITKFLILNTETDDKFVNTLNFKDLNIDKQQIISIFIVEGVLPKNFLSLTTPQNQLPRLKNAQKA
Ga0209491_1000576127F052406N/AMIRVDIFSFFASDVGELLKMQTRLNQWLAAGTLKKYEVHTTATHIIFNVSRLKD
Ga0209491_1000576131F006840N/AMSTFKMLRGRTILVDLPQRKESAIKLSEKDEDQVMKDAMKLWNKLTVYAVGDKVEDVAAGDKVYIRTSALNLESVERIDIDGGVKLVLNEGDVIIVW
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.