NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209491_10001312

Scaffold Ga0209491_10001312


Overview

Basic Information
Taxon OID3300027832 Open in IMG/M
Scaffold IDGa0209491_10001312 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)49019
Total Scaffold Genes38 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (7.89%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica

Source Dataset Sampling Location
Location NameLake Bonney
CoordinatesLat. (o)-77.714Long. (o)162.445Alt. (m)Depth (m)83
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003038Metagenome / Metatranscriptome511Y
F004953Metagenome / Metatranscriptome417Y
F012010Metagenome / Metatranscriptome284Y

Sequences

Protein IDFamilyRBSSequence
Ga0209491_1000131212F003038N/AMALSTTDLGTGETGMAKTIAPGNHTLKLNNIFLDDFKFIDGAKHLMLNLETEPIEGFEGFMINKDDESKGHYKGQIGRVKASQYAFADGETKSGIKIQRDRSVLIFLQNFCKALNINEWFIQQDGKHETIDAFIDAFNANAQFQDIYMDFCVAGKEYMSKTGYINYDMHIAKADKGAYGFGAKGNSKVMVYNEALHLKKTEVKTVTAFGDDDDDLSIPSKASSDFSLD
Ga0209491_1000131228F004953GAGMMLVQASWQEHQTFRMVPISEACPYVECIFDPNTKVFVVISKIKRVSLQMLPKLDEYGQPVTGPKGRKEERHKVEVFQEFYIEDKVAMKDLIHLFNVNADTFNYSHFMDEVVELDEAE
Ga0209491_100013127F012010N/AMTEIFNRLVKENITPNAYYVLHCIKDKIVPQKFINKELQVEKLKRDNWLNENLTLTPKSIIFIEELNGFFKKSKKKTSQILLGQDFIDKIQEYVEIFPNRKLSSGKYARVHAKNLEVSFRWFFENYDYEWQAILSATEKYVDEYSIRNYEYMRTAQYFIRKQSIDKSFESDLATYCDLINNSSEEDTFYFKDNVV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.