NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209060_10002057

Scaffold Ga0209060_10002057


Overview

Basic Information
Taxon OID3300027826 Open in IMG/M
Scaffold IDGa0209060_10002057 Open in IMG/M
Source Dataset NameSurface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)19785
Total Scaffold Genes26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)19 (73.08%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil → Surface Soil Microbial Communities From Centralia Pennsylvania, Which Are Recovering From An Underground Coalmine Fire.

Source Dataset Sampling Location
Location NameUSA: Pennsylvania, Centralia
CoordinatesLat. (o)40.7999Long. (o)-76.3402Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000380Metagenome / Metatranscriptome1210Y
F000812Metagenome / Metatranscriptome881Y
F003650Metagenome / Metatranscriptome475Y
F012707Metagenome / Metatranscriptome278Y

Sequences

Protein IDFamilyRBSSequence
Ga0209060_1000205710F000380GAGMPTQSQEQDTLNVKLVHFTKQNSPDEPVQVAFSVIDDQGKEEIITGEIPYSYDLFRLMQDNGWLNVRRGVSSIRDTRTQRRAVSA
Ga0209060_1000205716F003650N/AMYWGLLSVNWNGGLIPIIGLVAFGCPVAATGCQFNIAGLQEIQSQDAPQQNEENELFIETDSLLPDTYPGGNYEVHLAVRGGVPPLHWHLEKGALPAGIKLEDSGLIHGIAERAGEFQFTASVTDSGKPQQAFEKTFMIHVRSAMTVAWKTPAHVSGNRIEGSVEVSNTTPNNMDLTFIVLAVAGDGRATAIGYQHFELLKGTLAKELPFGETLPRGGYVVHVDVVGEVPPQDRIYRERLQTPGPLQVNVGP
Ga0209060_1000205721F000812AGGLADSASNPIDGPKPRRWTVFPAAFLLLALAVVVLYTSRNALLSPLALVVVAAIGLAALLLQLRLRKDLGKPVRAPLWLNFAGLIFALAAVFSDVLRLNTSGVYITALGAVFCFGISGVFVLHRLRQKRPH
Ga0209060_100020576F012707AGGAGMANKWIGLLLCAVFAACSLCVVAQESNSGKSKDSVRTFTGCLTKSGSGDEYVLTANDGSTWEAHANSSVDLASHVNQTVEAKGVVKNSTAHNLKEDSKDMAADTGMKKNNAEHGHLTITKLHTIADSCQR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.