Basic Information | |
---|---|
Taxon OID | 3300027784 Open in IMG/M |
Scaffold ID | Ga0207421_10269730 Open in IMG/M |
Source Dataset Name | Alkaline sediment microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 8KL_010_SED (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 720 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Russia: Kulunda Steppe, Lake Tanatar | |||||||
Coordinates | Lat. (o) | 51.39 | Long. (o) | 79.48 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F015656 | Metagenome / Metatranscriptome | 253 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0207421_102697302 | F015656 | N/A | MKVFPEYFDNNQFEMARSNLHTIKRPYINFYKTINFKFQEYNANIKLQCVHWHRLIRACINVYGYFDFLKQIRCMEAVEYFKQCIQLNSFFSYHKKYFPQEYYNNEYWRVSPHYDNVFVDSD |
⦗Top⦘ |