NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209500_10000383

Scaffold Ga0209500_10000383


Overview

Basic Information
Taxon OID3300027782 Open in IMG/M
Scaffold IDGa0209500_10000383 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)38495
Total Scaffold Genes51 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)29 (56.86%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025022Metagenome / Metatranscriptome203Y
F072274Metagenome / Metatranscriptome121Y
F085130Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0209500_1000038324F072274N/AVSLLVYVIMLMNTDGYISSDGTWAAVPWYGKKYISIYNGEQICVHHSLETAKKFIQKEIRKK
Ga0209500_1000038326F085130GGAMTSYYFWFGIFMFVGYLIVTDISVAYAFTLVSKLIRFQYEKQKWWLLNNPRNIIVRWMMYRNSMRMAEELMKEFAEKEKK
Ga0209500_1000038344F025022GGAMELTIVAYKLEDGLWAFDHPHNNTVQELLLNGTEEAIDEHFYFESGRHAVENDQMEIILNTEEPDDYDTLLVKEVGDEEGTTYTDTTLCAPVWLCPWLQGYFGEVPEEIFVKVRPINQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.