NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209086_10024971

Scaffold Ga0209086_10024971


Overview

Basic Information
Taxon OID3300027770 Open in IMG/M
Scaffold IDGa0209086_10024971 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3667
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (92.31%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000263Metagenome / Metatranscriptome1424Y
F002387Metagenome / Metatranscriptome565Y
F003603Metagenome / Metatranscriptome477Y
F007468Metagenome / Metatranscriptome350Y

Sequences

Protein IDFamilyRBSSequence
Ga0209086_1002497112F003603AGGCGGMKTKEEQIGELLANSVEDHFFNPAALGRYLADQPTYTLDRVMEVVAWIIEKQARRYDREVETGGKVSEGLAIAHKLDMVIDKIKITNDLKNIKLPITPKERAEFVKALPFESSQNYRYSWLHETNNQSNMYINQGM
Ga0209086_100249712F002387AGGAGGMASFLEDVNQMVIDAVYQDIAEQLLEDWINNNLDEGQYYADKQFAEMSGDKFIFDEFNKFYELKEGDDDYLDIL
Ga0209086_100249715F007468GGAGGLTTLTKSSKFIEYMKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNENER
Ga0209086_100249716F000263AGGMETLYADNELPSHLQRLVDAGVNGLDIMHGELKNLMLIAEEQLAWAQAIEDETEEAMDSMARTEAEGRLDALVELYKLTYDLSFAIGARNEASR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.