| Basic Information | |
|---|---|
| Taxon OID | 3300027759 Open in IMG/M |
| Scaffold ID | Ga0209296_1013557 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4808 |
| Total Scaffold Genes | 11 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (90.91%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Simoncouche, Canada | |||||||
| Coordinates | Lat. (o) | 48.2311 | Long. (o) | -71.2508 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028428 | Metagenome / Metatranscriptome | 191 | N |
| F031789 | Metagenome | 181 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209296_101355711 | F031789 | AGGA | MAYNQAFYPMGRTFVLSGTSTNQSANIYADSPCSQYLFVNHEPASTGQPVYVRISSTSGNNAAVANATSGNYGVPIRPAESIVLSGPQCSPTANVYITYITATGTANVYVTAGEGV |
| Ga0209296_10135573 | F028428 | GAGG | MSYGKSEYPVTPGKATLFYKDPSQKKNPNQPDWDGDLVLTRSYTEGQTLKLSIWKSMAKNGKEYFTIKENTYFKDKELADNAPKEVPAQYKPYGGSFKKNVDDDSDVPF |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |