NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209596_1002320

Scaffold Ga0209596_1002320


Overview

Basic Information
Taxon OID3300027754 Open in IMG/M
Scaffold IDGa0209596_1002320 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15741
Total Scaffold Genes38 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)30 (78.95%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000473Metagenome / Metatranscriptome1097Y
F000671Metagenome / Metatranscriptome945Y
F008814Metagenome / Metatranscriptome327Y
F020166Metagenome / Metatranscriptome225Y

Sequences

Protein IDFamilyRBSSequence
Ga0209596_100232025F008814N/AMDNKLTVLEEIIKEIGEELYQKWYNSLAVEDRTEEASKAMSSNAGETAVWVIQTFMNKFNKAADELKGE
Ga0209596_100232031F000671GAGGMSEKILCYSCNKTKNKLNAKRSSLLPINLFLCQTCIDEKLEPRWVILIAGRQNGHELVKDFIQKKKYIGAEITASELLI
Ga0209596_100232033F000473GGAMTFINKDKDHFKYGMNMWNGEPAKPVFYNQEMKKKLRELNKPMLLLMDVVRYPDFLALRLYEDNFIQFDGIEKEKVIDYVSKAKKLLESYGVRVELEGRPMA
Ga0209596_10023209F020166N/AMSKEPKIMKMDWRSLGYWPVWKDGKIVWEKDPHDK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.