| Basic Information | |
|---|---|
| Taxon OID | 3300027737 Open in IMG/M |
| Scaffold ID | Ga0209038_10000005 Open in IMG/M |
| Source Dataset Name | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 63760 |
| Total Scaffold Genes | 67 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 50 (74.63%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Calvert Island, British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 51.62 | Long. (o) | -128.09 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000703 | Metagenome / Metatranscriptome | 928 | Y |
| F032795 | Metagenome / Metatranscriptome | 179 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209038_1000000566 | F000703 | N/A | MTTIRAYTVGDLEALRAIHASQGFEYTLPDLNNPLFVTKLILSDTNQTETSEKNSGAKTKPPQEKIIGAALLRLTAEAYLLLDPKAGTPRERWQWLLQLHAATERDAWQRGLEDVHAWLPPPIARKFGKRITQLGWSRDDAWTPYCKRLACSAGQSCPSTK |
| Ga0209038_1000000567 | F032795 | N/A | YVGSLPSAPITFGSPPTAVAGGGSTGPTPLPSSGSGVLPNGQVRGGNGFGVNPGSRVVRQTVL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |