NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209998_10040813

Scaffold Ga0209998_10040813


Overview

Basic Information
Taxon OID3300027717 Open in IMG/M
Scaffold IDGa0209998_10040813 Open in IMG/M
Source Dataset NameArabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1053
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere → Arabidopsis Thaliana Rhizosphere Microbial Communities From The Joint Genome Institute, Usa, That Affect Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Walnut Creek, California
CoordinatesLat. (o)37.931388Long. (o)-122.021761Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002532Metagenome / Metatranscriptome551Y
F007708Metagenome / Metatranscriptome346Y

Sequences

Protein IDFamilyRBSSequence
Ga0209998_100408131F002532GGAGMKTLISIFAVTLALAFTGPAFAGASAAKTEADCTKAGGVWDAATKTCAAKPQ
Ga0209998_100408132F007708N/ARPVMVIDEGTCQLIGEAKGNEFDGVQEPLPDAMRVLLCLIDGAERRHRLVRKWQSQAAHDLHVEVEGGDIMVTLPGTSYAVTYYKLANSPQLHGRHLPDQVDRRSPISQAAFVGKAWKLANDKARELGWIG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.