| Basic Information | |
|---|---|
| Taxon OID | 3300027683 Open in IMG/M |
| Scaffold ID | Ga0209392_1000274 Open in IMG/M |
| Source Dataset Name | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 11365 |
| Total Scaffold Genes | 23 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 18 (78.26%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Microbial Communities From Cottonwood Lakes Research Site Near Jamestown, North Dakota, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | near Jamestown, North Dakota | |||||||
| Coordinates | Lat. (o) | 47.0956 | Long. (o) | -99.1001 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004477 | Metagenome / Metatranscriptome | 436 | Y |
| F028803 | Metagenome / Metatranscriptome | 190 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209392_100027410 | F028803 | AGGA | MTELVANEYGVEHDNIQIAKLRIHRTNGMWLVEYRRIPRWLFGLDRWWWFDDGTYTEYADASNRVDHLINVGYISKTRFQSVKEFEVNNG |
| Ga0209392_100027416 | F004477 | GAGG | MNVLSLLIDPIPVTSLEQLEIAKGKVQLSMMKLISFVLGLIMISVVLVMMIGLFIPNHVIDNNEIFKIIGPAFSMIVGAFVGAFATMMGMKTAEFDPNVKVQELGKTDHKVLAEAHVINAQAETIETENEIKMMAAIDKYHDSDEDHGPF |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |