NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209011_1000340

Scaffold Ga0209011_1000340


Overview

Basic Information
Taxon OID3300027678 Open in IMG/M
Scaffold IDGa0209011_1000340 Open in IMG/M
Source Dataset NameForest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)18455
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)19 (90.48%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameThunder Bay, Ontario, Canada
CoordinatesLat. (o)49.08Long. (o)-89.38Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001473Metagenome / Metatranscriptome688Y
F002396Metagenome / Metatranscriptome564Y
F003157Metagenome / Metatranscriptome504Y

Sequences

Protein IDFamilyRBSSequence
Ga0209011_100034010F003157AGGAGGMFDPDANQNRDNTDLWGFARFGGLDRLDWLMILISVLLGTIAKQHHVLDLPDWFLEWVSPFLLMAFGYKARRKITEVVESRRVRGKDTREE
Ga0209011_100034011F002396GAGGMRSLFPSTYDRADVLMSAGCSTFVSAALILVIPRVGIVLLEILLGLFFIGCALAARARLRIQARSQAKEGPEGSTNAKAKWFDRYDVLMILTVIVIYSSMSGLLRHAGLSEGTVGILPLILFAAGILLKPRAVQFIERRRKDRKAETHDGRPHMDAGEKQEIARKETVERCQ
Ga0209011_100034016F001473GGAGMESEYQTVGQMYERLRLMIRQRNDTGFRLAVTDAILEPRNPFEPANKRRPKSVVAITLILVLVLSLIFLYFSFHHAR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.