NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208975_1040945

Scaffold Ga0208975_1040945


Overview

Basic Information
Taxon OID3300027659 Open in IMG/M
Scaffold IDGa0208975_1040945 Open in IMG/M
Source Dataset NameFreshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1448
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies

Source Dataset Sampling Location
Location NameGreat Lakes, Michigan, USA
CoordinatesLat. (o)44.701094Long. (o)-82.854085Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000441Metagenome / Metatranscriptome1136Y
F001019Metagenome / Metatranscriptome804Y
F003603Metagenome / Metatranscriptome477Y
F024786Metagenome / Metatranscriptome204Y

Sequences

Protein IDFamilyRBSSequence
Ga0208975_10409451F000441N/AYINEQLSKAQALLWSGSLHEVDEAHNIIAKLINDRMSEKEGTNV
Ga0208975_10409452F001019AGGAGGMSNYEPSLEILEVNYSCSPGGIDTFEVYDKSEIEPVSLPIYETESLTEAVMFCYNLGKDFIVRTYAEWESRELASL
Ga0208975_10409453F024786GGAGLPVYRVFGNKYQNYYTILDAADEFQAVDLANALPETEWNSIPTDDVIEATDVYLNEDTSYNVQLNI
Ga0208975_10409455F003603AGGCGGMKTKEHQIGELLSNSVEDHFFNPAALGRYLAEQPIYTIDRVMEVVAWIIEKQAERYRREVANDGTICEGLIIANMLDKMIDKIKVSNDLKSVQLPITPKERGEFIKSLPETKEQNYRYSWLHDTDNKTKVTIDHPFI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.