NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208975_1019398

Scaffold Ga0208975_1019398


Overview

Basic Information
Taxon OID3300027659 Open in IMG/M
Scaffold IDGa0208975_1019398 Open in IMG/M
Source Dataset NameFreshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2245
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies

Source Dataset Sampling Location
Location NameGreat Lakes, Michigan, USA
CoordinatesLat. (o)44.701094Long. (o)-82.854085Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003304Metagenome494N
F022371Metagenome / Metatranscriptome214Y

Sequences

Protein IDFamilyRBSSequence
Ga0208975_10193982F003304N/AMKQALVTQSFGEDWQKIIDLTRPRMEAYCKRHSTDFILIDKPLTHPAQYSKSAIGNIMATKGYDQVTFVDADVLIAADCPKLSDDAGVFCAFDEGAYLDRKPDMVKLAGAFGGMIEPKFYVNTGVFVVHTKAVGVLSMPPIGLHPNHFAEQTWLNVMAHLWNIPLTELDPSFNCMTSVESHFGLDRYKDAMIIHYAGQSNDLVKLANQIKADEAKLVELGR
Ga0208975_10193984F022371AGGAMFCLLDLTGVVWVIGWFVLYSSMTLSAIYCALYIIFKLIDYIKKELDL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.