| Basic Information | |
|---|---|
| Taxon OID | 3300027631 Open in IMG/M |
| Scaffold ID | Ga0208133_1114660 Open in IMG/M |
| Source Dataset Name | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 627 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Columbia River Estuary | |||||||
| Coordinates | Lat. (o) | 46.234 | Long. (o) | -123.9135 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006987 | Metagenome | 360 | Y |
| F104761 | Metagenome | 100 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208133_11146601 | F006987 | N/A | MTNWSPVWRVTIEGVVVTNTVLANLSISSGRTNIYTQAQAGYCTVNLINLDQGAIPAKINDTVTIEVKNTAGTYVAIFGGSVVDVTVAVSQVGSVTITQEVTITALGALARLQKALTN |
| Ga0208133_11146602 | F104761 | N/A | TGTGSTTTSSAGVKSAVSGAAIAGGFTDSQNAARLAAMGGGGFTDSQNAARISITVNGAIDAEGTARTIVNTLNDSYYRGTGGGGNLVAL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |