| Basic Information | |
|---|---|
| Taxon OID | 3300027622 Open in IMG/M |
| Scaffold ID | Ga0209753_1013086 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_550m (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2824 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Oxygen Minimum Zone In The Mesopelagic Equatorial Pacific |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 8.0 | Long. (o) | -156.0 | Alt. (m) | Depth (m) | 550 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001334 | Metagenome / Metatranscriptome | 720 | Y |
| F003285 | Metagenome / Metatranscriptome | 496 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209753_10130862 | F003285 | GAGG | MPEQESIHQLQTEIQTLKIKDEFRTKELDALMEKLSDTSSKLNALSENIGRLLAGQELHKASDNEVRDELKILHTRIGDLHDKCTEMIDKTETRVSSDISLLYNKVDSLEKWRWITIGIATAFAWLLTNIIPKFLDN |
| Ga0209753_10130863 | F001334 | GGA | MMKFKEYLQLNADDSIEQIMSGEWIQKSRSTWKVTDDEDNKIEIHNDGHDPELNGESWAVHTNTFAPKAFAFFCKQFIKEVKPSEVTHARTRIYPSTSN |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |