Basic Information | |
---|---|
Taxon OID | 3300027616 Open in IMG/M |
Scaffold ID | Ga0209106_1073152 Open in IMG/M |
Source Dataset Name | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 768 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | El Dorado National Forest, Georgetown, California, USA | |||||||
Coordinates | Lat. (o) | 38.88 | Long. (o) | -120.64 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F094117 | Metagenome / Metatranscriptome | 106 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209106_10731522 | F094117 | GGCGG | LRGGAAVYGLQKVWLSSIKQQLATQRVTIPQMQMKPIPAVDPAQFRAALYPKIDPKIGQDAWRGTLNRQINQSINAGRMVPLPPRIYIPR |
⦗Top⦘ |