| Basic Information | |
|---|---|
| Taxon OID | 3300027608 Open in IMG/M |
| Scaffold ID | Ga0208974_1015173 Open in IMG/M |
| Source Dataset Name | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2441 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Great Lakes, Michigan, USA | |||||||
| Coordinates | Lat. (o) | 44.504638 | Long. (o) | -83.045851 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001599 | Metagenome / Metatranscriptome | 665 | Y |
| F004721 | Metagenome / Metatranscriptome | 426 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208974_10151734 | F001599 | AGGTGG | MEETVSIAWCDNGMVDGKFMQGVTDVMLHSGVPFATTLRSQGNQIGRQRETIVNYWYNNKKSDWLLWVDSDVVISPEVFLKLWKKKDALTKPLLTGVYFTTDTPEEPLMVPMPTVFEFVNEENSVGIKRLHPLPENQFLKVGAAGMGFVLMHRSVVEKIKEAVPGAPLFTEIGVDKSFMGEDIYFFALCDKADIPVWCDTSALVPHMKRFSFDEHYYKAFMGAPAKEQPKSKIITPNRK |
| Ga0208974_10151735 | F004721 | AGGAG | MALGKEGSSFNAELNRLAGTTGKADQGAANAYASTSGKGILGALNIKASASRQPNDFKGLNAICNELAGTTGKSALAALRSINV |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |