Basic Information | |
---|---|
Taxon OID | 3300026995 Open in IMG/M |
Scaffold ID | Ga0208761_1003781 Open in IMG/M |
Source Dataset Name | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1083 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Rhizosphere Microbial Communities From Centre Inrs-Institut Armand-Frappier, Laval, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Laval, Canada | |||||||
Coordinates | Lat. (o) | 45.54 | Long. (o) | -73.72 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001996 | Metagenome / Metatranscriptome | 607 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208761_10037812 | F001996 | N/A | MPMMTPEMSATLLRPSAPSRFRRGPSRPTVETLMDQIAGLTSERQRLRDRGVNGSRLERNRVKLARAQWELSHALIERYL |
⦗Top⦘ |