Basic Information | |
---|---|
Taxon OID | 3300026825 Open in IMG/M |
Scaffold ID | Ga0209909_100437 Open in IMG/M |
Source Dataset Name | Cyanobacterial communities from the Joint Genome Institute, California, USA - FECB-22 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 26723 |
Total Scaffold Genes | 33 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 27 (81.82%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Cyanobacterial → Cyanobacterial Communities From The Joint Genome Institute, California, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 37.9313884 | Long. (o) | -122.0239394 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F080441 | Metagenome / Metatranscriptome | 115 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209909_10043725 | F080441 | N/A | MLALGGCAVVNSAPSSQEVVQLRDVRDQCLMQNAIRLDDGRSDPQAIAASVVAACQSENQALITAIAGPDGFRQSEIARQIQQNSQQAATQYVLQVRAARTRS |
⦗Top⦘ |