Basic Information | |
---|---|
Taxon OID | 3300026710 Open in IMG/M |
Scaffold ID | Ga0207846_102730 Open in IMG/M |
Source Dataset Name | Marine sediment microbial community from La Parguera, Puerto Rico - PR Tt Sediment 3 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1177 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bioluminescent Bay, La Paraguera, Puerto Rico | |||||||
Coordinates | Lat. (o) | 17.96725 | Long. (o) | -67.0188733 | Alt. (m) | Depth (m) | .4 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F047064 | Metagenome / Metatranscriptome | 150 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0207846_1027303 | F047064 | AGGA | METIEIKARRSWDRQVLEYFEDLDIICNDYNRTILRYLGKLNRLLHEERIDQSEYDALNRDLLKVSEALNQVPRTIKDIK |
⦗Top⦘ |