NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255274_1054015

Scaffold Ga0255274_1054015


Overview

Basic Information
Taxon OID3300026570 Open in IMG/M
Scaffold IDGa0255274_1054015 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1056
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.4271Long. (o)-81.6053Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002071Metagenome / Metatranscriptome596Y
F005177Metagenome / Metatranscriptome409Y

Sequences

Protein IDFamilyRBSSequence
Ga0255274_10540151F002071N/ALPPRERKEMSTTLEIGQTITTAKSGVVGVIKAVDNHPSGVSRVLLDVNGTERWTSVSN
Ga0255274_10540153F005177AGCAGMKNRFRVEIYDEDKNNDLTIYSEQGVDKEYLTELVFSNLRRFSGNVRAYVYDSLKKRKTTALYLPMEVIPKKTELTKLLG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.