NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256815_1031264

Scaffold Ga0256815_1031264


Overview

Basic Information
Taxon OID3300026463 Open in IMG/M
Scaffold IDGa0256815_1031264 Open in IMG/M
Source Dataset NameSediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 CS6
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)631
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment → Sediment Microbial Communities From Tidal Freshwater Marsh On Altamaha River, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.3377Long. (o)-81.4644Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F073724Metagenome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0256815_10312641F073724N/AVVGDEELEMFDAMILKREIVRTCRLDVRILETFKDGLVLRVENIVNGNSLSLITDFVNKHQLNMLFDNGVYFISIEMLSPSEPAYLSE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.