Basic Information | |
---|---|
Taxon OID | 3300026282 Open in IMG/M |
Scaffold ID | Ga0209053_1006982 Open in IMG/M |
Source Dataset Name | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_7/15/2010_ DNA (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3216 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Madison, Wisconsin, USA | |||||||
Coordinates | Lat. (o) | 43.076217 | Long. (o) | -89.411742 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F088925 | Metagenome / Metatranscriptome | 109 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209053_10069821 | F088925 | AGGAG | MQDQKCSKCGSRNVYKNTGKNWCQDGIVLQMIAVDRFTYQFKTEAFLCLDCRYLEIRAAETNTVYGDHKTLIEAVEASNNWAKVSV |
⦗Top⦘ |