Basic Information | |
---|---|
Taxon OID | 3300026121 Open in IMG/M |
Scaffold ID | Ga0207683_10265384 Open in IMG/M |
Source Dataset Name | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1568 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Michigan, Kellogg Biological Station | |||||||
Coordinates | Lat. (o) | 42.3948 | Long. (o) | -85.3738 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002401 | Metagenome / Metatranscriptome | 563 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0207683_102653843 | F002401 | N/A | LYVCVVGSGPTLRQTAIEYAEKVGAMCSKHPEMGPCQYERNACRSQGGRVFAANGSEITMATEAEYDKKVRRVTFKSN |
⦗Top⦘ |