NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207683_10206241

Scaffold Ga0207683_10206241


Overview

Basic Information
Taxon OID3300026121 Open in IMG/M
Scaffold IDGa0207683_10206241 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1788
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011234Metagenome / Metatranscriptome293Y
F022224Metagenome / Metatranscriptome215N

Sequences

Protein IDFamilyRBSSequence
Ga0207683_102062412F022224GGGGGMNRMTWIAAAVAACAASISPSQAFTDADLDRLAAEILESKTAPGVGDAINDLSSELIECSAITMVSAICIGKTPGQDSNAGQPLENISSWTGKLGVILGSGVGLSERALSTRLRVTADDIMRDVSSSCRNLSVLFERIRKSCEALVASPTNRLKQILVARQPSLYEK
Ga0207683_102062414F011234GAGGMSLQEAASQAGRRATKFCPANVQKIKDFVAQGMSRQEIAEFLDVPLGSLQVTCSRLGISLRRRRVLNGDASHPPIVGHMRVDGQFQISIECGGMRRATAVPLTDSDIAQLALAAAVRNVGMTQLLSEVV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.