NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207665_10174789

Scaffold Ga0207665_10174789


Overview

Basic Information
Taxon OID3300025939 Open in IMG/M
Scaffold IDGa0207665_10174789 Open in IMG/M
Source Dataset NameCorn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1553
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan: Kellogg Biological Station
CoordinatesLat. (o)42.4774Long. (o)-85.451Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008329Metagenome / Metatranscriptome335Y
F046666Metagenome / Metatranscriptome151Y

Sequences

Protein IDFamilyRBSSequence
Ga0207665_101747891F046666AGGGGGMGYSCSERLAGTYLVPHPWLTMPSWPTVERIARARLTALAAPPDFLALDKVATVVQERYAQVLWIRLQAADNDPGALLVTLLGAAARLDAVASQGIAEDVTRHARHGEWQVGLQLLADWLVAATIPPAVLVLEGAEHLEADSPASLDMLVSAFLPRLQGALDV
Ga0207665_101747893F008329AGGAGGMTAAPPCPQDQNFNILTGFLTPGSDTGPGALDGSISVDVLDPTEGNERVRAVEVTDPWNLEVDWCVCGRFADLICGCWCVQVFIDDIDGVGPTSGLLGSARVSTNTTTDSEGEDTATKCFEYTFTFPAGSVGAGVYNLVVLITLSASGCEEQGRLVQDMVGWAVIPVVVFFDESAP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.