NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207669_10340779

Scaffold Ga0207669_10340779


Overview

Basic Information
Taxon OID3300025937 Open in IMG/M
Scaffold IDGa0207669_10340779 Open in IMG/M
Source Dataset NameMiscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1154
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017350Metagenome / Metatranscriptome241Y
F020724Metagenome / Metatranscriptome222Y

Sequences

Protein IDFamilyRBSSequence
Ga0207669_103407792F020724AGGCGGMARLATILDVVSDASLEIGIVQRPVSNIVGTADQDIAQMTALLQNVADELLLDPPYRDQLGDGNWLIDAGLVVKKSRPTADNDIVLFDARLAVDGLKYRFLKSKGLEYGEEQRDFIARLNKIAGRNAPVIDLNEDVGRMQ
Ga0207669_103407793F017350GGAGMSDTPTLVRFSSGWERDGNGPDGLPLYRETIRVRMDRPPYLALEREAEEADITDHPGPYELYQKTCGARKAIVGYPLALWPACPPHIFQMCAVRDIHTVEQLAQLMNKKRRAEALKTMPPEIVEVADRAVQMMELHSKAGQYEAIVTDLQSQLAAMKEQYDEAVSTISAQKTLIDALRLKAAA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.