| Basic Information | |
|---|---|
| Taxon OID | 3300025891 Open in IMG/M |
| Scaffold ID | Ga0209585_10048919 Open in IMG/M |
| Source Dataset Name | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1559 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Barrow Environmental Observatory site, Alaska | |||||||
| Coordinates | Lat. (o) | 71.299 | Long. (o) | -156.61 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005812 | Metagenome / Metatranscriptome | 389 | Y |
| F010606 | Metagenome / Metatranscriptome | 301 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209585_100489192 | F010606 | N/A | MRAVLAAIALLLLALPTRAEEERVRIPDGCRELADRAGLPLTLIHAEAARAIAYIRVMLSQDAAVARCRLALRSF |
| Ga0209585_100489193 | F005812 | AGG | MTGWRAILAALIGAIAGSVITAGVFVYTGTKVLQERTARELLSEVVALVSLQEGWLLQGEGSRTAKLSDHPGLPEAQSGSGLWLLPVELRAILDEAQWNSPSDPSYGFVQGRKVWIIRNETLPDAPLSYSGVTQEHFPALISSAGRQELCAWIERVQIAYNGGTLTDRGLAPLRPYLVP |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |