Basic Information | |
---|---|
Taxon OID | 3300025890 Open in IMG/M |
Scaffold ID | Ga0209631_10002320 Open in IMG/M |
Source Dataset Name | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 22922 |
Total Scaffold Genes | 36 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 12 (33.33%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Helgoland, sampling site Kabeltonne | |||||||
Coordinates | Lat. (o) | 54.184167 | Long. (o) | 7.9 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F012177 | Metagenome | 283 | Y |
F036975 | Metagenome / Metatranscriptome | 169 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209631_1000232018 | F012177 | N/A | MTEIERFWLDLMDARRYAITEVYGAECASRYKPHPIEREYFINNRGTFSAHPSVTEHTKAFWVMCETHYTTQREAYRRKLRANWHMVQQSTEYKNRKRERELLKDYISDAINGNGKEADARTTKEKGR |
Ga0209631_100023209 | F036975 | GGA | MAQGSLEQKGGKVGFEGIGADIKPLMKQFEQMRKQVSNPKIQKQIHRAVGKIYKDEMLNNIVDARETIRIRRGGKGGFDIKAGTLRRSIKVWLIDKQKSTYWVGPRAGKRAPKDGDGWFANIVEGDDQYVKGNNRNKGVFTRSIANKRGEALTKMRKKYEFQIRKAAKAKGKKK |
⦗Top⦘ |